Recombinant Mesocricetus auratus 3 beta-hydroxysteroid dehydrogenase/Delta 5-->4-isomerase type 1 (HSD3B1)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and the protein's inherent stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
HSD3B1; 3 beta-hydroxysteroid dehydrogenase/Delta 5-->4-isomerase type 1; 3 beta-hydroxysteroid dehydrogenase/Delta 5-->4-isomerase type I; 3-beta-HSD I; 3-beta-hydroxy-5-ene steroid dehydrogenase; 3-beta-hydroxy-Delta(5-steroid dehydrogenase; 3-beta-hydroxysteroid 3-dehydrogenase; Delta-5-3-ketosteroid isomerase; Dihydrotestosterone oxidoreductase; Steroid Delta-isomerase
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
2-373
Protein Length
Full Length of Mature Protein
Species
Mesocricetus auratus (Golden hamster)
Target Names
HSD3B1
Target Protein Sequence
PGWSCLVTGAGGFLGQRIIRMLVQEKELQEVRALDKVFRPETREEFCKLQTKTKVTVLEG DILDAQCLRRACQGISVVIHTAAAIDVFGAIPRQTIIDINLKGTLNLLEACVQASVPAFI YTSSIDVAGPNSYKEIVLNGHEEQQHESTWSDPYPYSKKMAEKAVLAANGSSLKNGGTLH TCALRPMYIYGEKSPLISVTIIRAVKNSGILDVTGKFSTVNPVYVNNAAWAHILAARGLQ DPRKSPNIQGQFYYISDDTPHQSYDDLNYVLSKDWGLRPDSSWRPPVALLYWLGFLLELV SFLLRPVYNYQPPFNRHLVTLSNTVFTFSYKKAQRDLGYEPLVGWEEARENTSEWIGSLV EQHKGTLNTKAQ
Uniprot No.

Target Background

Function
Recombinant *Mesocricetus auratus* 3β-hydroxysteroid dehydrogenase/Δ5→4-isomerase type 1 (HSD3B1) is a bifunctional enzyme crucial for steroid hormone biosynthesis. It catalyzes the oxidation and isomerization of 3β-hydroxy-Δ(5)-steroid precursors to 3-oxo-Δ(4)-steroids. Specifically, it converts pregnenolone to progesterone, 17α-hydroxypregnenolone to 17α-hydroxyprogesterone, dehydroepiandrosterone (DHEA) to 4-androstenedione, and androstenediol to testosterone. Furthermore, it interconverts 3β-hydroxy and 3-oxo-5α-androstane steroids, influencing the bioavailability of active forms. Importantly, it converts dihydrotestosterone to its inactive form, 5α-androstanediol, which does not bind to the androgen receptor (AR). It also converts androstanedione, a precursor of testosterone and estrone, to epiandrosterone. NAD+ is the preferred electron donor for 3β-hydroxysteroid dehydrogenase activity, while NADPH is preferred for 3-ketosteroid reductase activity.
Protein Families
3-beta-HSD family
Subcellular Location
Endoplasmic reticulum membrane; Single-pass membrane protein. Mitochondrion membrane; Single-pass membrane protein.
Tissue Specificity
High levels in adrenal gland, kidney and male liver. Low levels in female liver.

Q&A

What is the biological significance of HSD3B1 in steroidogenesis?

HSD3B1 encodes 3β-hydroxysteroid dehydrogenase-1, a critical enzyme in steroid hormone biosynthesis that catalyzes the conversion of adrenal precursor steroids to more potent androgens. Specifically, it facilitates the conversion of dehydroepiandrosterone (DHEA) to potent androgens like 5α-dihydrotestosterone (DHT) . This enzyme plays a fundamental role in the peripheral metabolism of adrenal steroids and represents a key link between adrenal and gonadal steroid hormone pathways. In human physiology, HSD3B1 expression patterns differ from those of HSD3B2, with HSD3B1 predominantly expressed in peripheral tissues rather than classic steroidogenic organs .

Methodologically, when studying HSD3B1 function, researchers should employ both substrate conversion assays (measuring the depletion of DHEA and production of downstream metabolites) and protein expression analyses to comprehensively characterize enzymatic activity patterns across different tissues.

How do species differences impact research using Mesocricetus auratus HSD3B1?

While Mesocricetus auratus (golden hamster) HSD3B1 shares significant homology with human HSD3B1, researchers must account for species-specific differences in:

  • Substrate specificity profiles

  • Catalytic efficiencies

  • Regulatory mechanisms

  • Post-translational modifications

When designing comparative studies, researchers should implement parallel assays using both human and hamster enzymes under identical experimental conditions to quantify functional differences. Cross-species validation is particularly important when extrapolating mechanistic findings to human disease models or when developing therapeutic interventions targeting this pathway.

What experimental systems best preserve native HSD3B1 function?

Expression SystemAdvantagesLimitationsRecommended Application
Mammalian cell lines (HEK293, CHO)Post-translational modifications preserved, membrane association maintainedHigher cost, lower yieldFunctional studies, protein-protein interactions
Insect cells (Sf9, High Five)Higher expression levels, eukaryotic processingSome glycosylation differencesStructural studies, high-throughput enzymatic assays
E. coliHigh yield, cost-effectiveLack of post-translational modificationsInitial activity screening, mutagenesis studies
Cell-free systemsRapid production, minimal contaminationLimited post-translational modificationsPreliminary functional assessment

For optimal preservation of native enzymatic function, mammalian expression systems are recommended despite their higher cost and lower yield. When using recombinant systems, verification of proper folding through circular dichroism spectroscopy and enzymatic activity assays is essential before proceeding to complex experimental designs.

How does the HSD3B1(1245A>C) polymorphism influence enzyme function?

The HSD3B1 gene contains a clinically significant missense-encoding polymorphism (rs1047303) at position 1245, resulting in either an adenine (A) or cytosine (C) variant. These variants encode functionally distinct enzymes with profound consequences for steroid metabolism:

  • The adrenal-restrictive (AR) HSD3B1(1245A) allele: Encodes an enzyme that undergoes rapid proteasome-mediated degradation, limiting conversion of DHEA to DHT .

  • The adrenal-permissive (AP) HSD3B1(1245C) allele: Encodes an enzyme with greater stability, maintaining higher steady-state protein levels and enabling enhanced DHT synthesis .

Research methodologies to analyze these differences should include protein half-life assays, ubiquitination studies, and substrate conversion rate measurements under standardized conditions. Pulse-chase experiments are particularly valuable for quantifying differences in enzyme turnover rates between variants.

What analytical approaches best quantify differential activity of HSD3B1 variants?

Analytical MethodData ObtainedTechnical Considerations
Liquid chromatography-mass spectrometry (LC-MS/MS)Precise quantification of substrate and metabolite concentrationsRequires specialized equipment, high sensitivity for steroid detection
Radiolabeled substrate conversionDirect measurement of enzymatic activity ratesRadiation safety protocols necessary, limited by isotope half-life
Western blotting with variant-specific antibodiesProtein expression levels and stabilityMay require development of variant-specific antibodies
Real-time PCR for mRNA expressionTranscriptional regulation patternsDoes not capture post-transcriptional differences
Cell-based reporter assaysFunctional activity in cellular contextMust control for transfection efficiency and cell type differences

For comprehensive characterization, researchers should implement at least two complementary approaches, typically combining a direct activity measurement (LC-MS/MS) with protein expression analysis (Western blotting).

How do HSD3B1 genotypes impact prostate cancer treatment outcomes?

Multiple studies have established associations between HSD3B1 genotypes and clinical outcomes in prostate cancer, particularly in the context of androgen deprivation therapy (ADT). The evidence indicates:

This apparent contradiction highlights the complexity of androgen signaling pathways and the need for contextual interpretation of genotype effects. Methodologically, researchers should stratify patient cohorts by disease volume, prior treatments, and concurrent medications when analyzing genotype-outcome associations.

What is the relationship between HSD3B1 genotype and glucocorticoid responsiveness in inflammatory diseases?

Recent research has uncovered a novel relationship between HSD3B1 genotypes and glucocorticoid responsiveness in asthma, with potential implications for other inflammatory conditions:

  • Patients with the homozygous adrenal-restrictive HSD3B1(1245A) genotype who are treated with oral glucocorticoids show significantly worse forced expiratory volume in 1 second (FEV1PP) compared to those not on glucocorticoids (54.3% vs. 75.1%; P < 0.001) .

  • In contrast, patients homozygous for the adrenal-permissive HSD3B1(1245C) genotype show no significant difference in FEV1PP between glucocorticoid-treated and untreated groups (73.4% vs. 78.9%; P = 0.39) .

  • These findings were independently confirmed in a second cohort (SARP I&II) .

The data suggest that glucocorticoid suppression of adrenal DHEA-S production may limit substrate availability for 3β-HSD1, particularly affecting those with the adrenal-restrictive genotype that already has impaired enzyme function. This represents the first genetic evidence implicating an androgen synthesis variant in resistance to glucocorticoids for inflammatory disease .

Research methodologies should include serum DHEA-S measurements alongside clinical outcomes when studying glucocorticoid responsiveness, and statistical models should incorporate interaction terms between genotype and treatment.

How can researchers optimize expression and purification of recombinant HSD3B1?

Successful expression and purification of functional recombinant HSD3B1 requires careful attention to several technical aspects:

  • Expression System Selection:

    • For structural studies: Insect cell systems with histidine tags

    • For functional assays: Mammalian cell lines (HEK293T, CHO cells)

    • For high-throughput screening: Bacterial systems with fusion partners

  • Purification Strategy:

    • Two-step chromatography (affinity followed by size exclusion)

    • Detergent selection critical for membrane-associated enzyme

    • Buffer optimization to maintain native conformation

  • Stabilization Approaches:

    • Addition of substrate analogs during purification

    • Reduced temperature during expression and handling

    • Glycerol or specific lipid addition to buffers

  • Quality Control Metrics:

    • Enzymatic activity relative to native enzyme preparations

    • Circular dichroism to confirm secondary structure

    • Thermal shift assays to verify stability

When working with Mesocricetus auratus HSD3B1 specifically, expression in cell lines adapted for hamster protein expression may improve yield and proper folding. Verification of proper folding and activity must precede experimental use .

What techniques enable precise genotyping of HSD3B1 variants in research samples?

Genotyping MethodAdvantagesLimitationsSuitability
Whole-genome sequencingComprehensive genomic profile, additional variantsCost, complex data analysisLarge-scale studies with broader genetic analysis
Targeted next-generation sequencingModerate cost, multiple variants simultaneouslyRequires specialized equipmentMedium to large cohorts, discovery studies
TaqMan PCR assaysRapid, cost-effective, high throughputLimited to known variantsLarge cohorts, clinical testing
Sanger sequencingGold standard for variant confirmationLabor-intensive, lower throughputValidation, small-scale studies
RFLP analysisSimple equipment needs, low costLabor-intensive, prone to errorsResource-limited settings

As demonstrated in the Severe Asthma Research Program (SARP) studies, whole-genome sequencing with appropriate quality control is a reliable approach for HSD3B1 genotyping, with direct confirmation methods showing 100% concordance . For clinical application research, TaqMan assays offer the best balance of throughput, cost, and accuracy.

How can researchers address the challenge of HSD3B1 substrate availability in experimental systems?

The dual-function nature of HSD3B1 (3β-hydroxysteroid dehydrogenase and Δ5→4-isomerase activities) presents challenges for experimental design. Researchers should consider:

  • Substrate Selection Strategies:

    • Radiolabeled vs. stable isotope-labeled substrates

    • Natural substrates vs. synthetic analogs

    • Precursor specificity (pregnenolone, DHEA, etc.)

  • Substrate Delivery Approaches:

    • Cyclodextrin complexation for hydrophobic steroids

    • Liposomal formulations for cell-based assays

    • Controlled release systems for in vivo studies

  • Metabolism Monitoring:

    • Time-course sampling to capture reaction kinetics

    • Multi-analyte detection methods (LC-MS/MS)

    • Parallel assessment of competing pathways

  • Experimental Controls:

    • Enzyme-free negative controls

    • Positive controls with established enzyme preparations

    • Specific inhibitor controls to confirm pathway specificity

When working with recombinant systems, researchers should verify substrate accessibility through binding assays prior to functional experiments, particularly when comparing variants with potentially different substrate binding properties.

How might HSD3B1 genotyping inform personalized medicine approaches?

The demonstrated associations between HSD3B1 genotypes and treatment outcomes in both prostate cancer and asthma suggest significant potential for personalized medicine applications:

  • Prostate Cancer Applications:

    • Stratification of patients for intensity of androgen deprivation therapy

    • Selection of appropriate adjunctive treatments based on genotype

    • Monitoring protocols tailored to risk of progression

  • Respiratory Disease Applications:

    • Identification of patients at risk for glucocorticoid resistance

    • Consideration of alternative or supplementary treatments

    • Dosing strategies based on genotype-associated responsiveness

  • Implementation Considerations:

    • Pre-treatment genotyping protocols

    • Integration with other predictive biomarkers

    • Cost-effectiveness evaluations of genotype-guided approaches

Methodologically, researchers should design prospective studies with pre-specified genotype-based treatment algorithms to validate the clinical utility of HSD3B1 genotyping. These studies should include comprehensive outcome measures beyond the primary endpoint to capture the full range of potential genotype effects.

What are the technical challenges in developing HSD3B1 variant-specific antibodies?

Development of variant-specific antibodies capable of distinguishing between products of the HSD3B1(1245A) and HSD3B1(1245C) alleles presents significant technical challenges that researchers must address:

  • Epitope Selection Strategy:

    • Peptide design encompassing the variant position

    • Consideration of conformational differences

    • Accessibility in native protein structure

  • Validation Approaches:

    • Testing against recombinant variants and native samples

    • Cross-reactivity assessment with related enzymes (HSD3B2)

    • Functional blocking experiments to confirm specificity

  • Application-Specific Optimization:

    • Buffer conditions for western blotting vs. immunohistochemistry

    • Sample preparation to preserve epitope accessibility

    • Signal amplification strategies for low-abundance detection

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.